Browse Products By Molecule:

Products --> MABSol® Biotin Labeled Proteins

Biotinylated Human EGFRvIII, Avi Tag (Avitag™)  pdf  pdf  pdf


Cat-Pack Size Price(USD) Qty Inventory Order
Quote for bulk   Worldwide Shipping & Payment
EGR-H82E0-25ug
    $350.00
EGR-H82E0-200ug
    $1380.00
In-Stock
Place Purchase Orders


Synonym

EGFR,ERBB,ERBB1,HER1,PIG61,mENA

Source

MABSol®Biotinylated Human EGFRvIII (EGR-H82E0) is expressed from human 293 cells (HEK293). It contains AA Leu 25 - Ser 645 (Accession # NP_005219.2) while the amino acids 30-297 are missing.

Predicted N-terminus: Leu 25

Molecular Characterization

This protein carries an Avi tag (Avitag™) at the C-terminus, followed by a polyhistidine tag.

The protein has a calculated MW of 41.3 kDa. As a result of glycosylation, the protein migrates as 60-70 kDa under reducing (R) condition, and 60-70 kDa under non-reducing (NR) condition (SDS-PAGE).

Biotinylation

Biotinylation of this product is performed using Avitag™ technology. Briefly, the single lysine residue in the Avitag is enzymatically labeled with biotin.

Endotoxin

Less than 1.0 EU per μg by the LAL method.

 

Purity

>95% as determined by SDS-PAGE.

Formulation

Lyophilized from 0.22 μm filtered solution in PBS, pH7.4. Normally trehalose is added as protectant before lyophilization.

Contact us for customized product form or formulation.

Reconstitution

Please see Certificate of Analysis for specific instructions.

For best performance, we strongly recommend you to follow the reconstitution protocol provided in the CoA.

Storage

For long term storage, the product should be stored at lyophilized state at -20°C or lower.

Please avoid repeated freeze-thaw cycles.

No activity loss is observed after storage at:

  1. 4-8°C for 12 months in lyophilized state;
  2. -70°C for 3 months under sterile conditions after reconstitution.
 

SDS-PAGE

Biotinylated Human EGFRvIII, His Tag (Catalog # EGR-H82E0) SDS-PAGE gel

Biotinylated Human EGFRvIII, His Tag on SDS-PAGE under reducing (R) and no-reducing (NR) conditions. The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 95%.

Bioactivity

Biotinylated Human EGFRvIII, His Tag (Catalog # EGR-H82E0) ELISA bioactivity

Immobilized CetuxiMabat 2 μg/mL (100 μL/well) can bind Biotinylated Human EGFRvIII (Cat# EGR-H82E0) with a linear range of 0.4-25 ng/mL.

Request for protocol

 

Amino Acid Sequence

LEEKKGNYVVTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCNLLEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGVMGENNTLVWKYADAGHVCHLCHPNCTYGCTGPGLEGCPTNGPKIPSGLNDIFEAQKIEWHEHHHHHH

Background

The epidermal growth factor receptor (EGFR; ErbB-1; HER1 in humans) is the cell-surface receptor for members of the epidermal growth factor family (EGF-family) of extracellular protein ligands. The epidermal growth factor receptor is a member of the ErbB family of receptors, a subfamily of four closely related receptor tyrosine kinases: EGFR (ErbB-1), HER2/c-neu (ErbB-2), Her 3 (ErbB-3) and Her 4 (ErbB-4). Mutations affecting EGFR expression or activity could result in cancer. The type III EGF deletion-mutant receptor (EGFRvIII) is the most common mutation and was first identified in primary human glioblastoma tumors; EGFR gene amplification is correlated with the structural rearrangement of the gene. The EGFRvIII gene has an in-frame deletion of 801 base pairs, corresponding to exons 2–7 in the mRNA, resulting in the deletion of amino acids 30-297 in the extracellular domain and the generation of a glycine at the fusion point

References

Please contact us via TechSupport@acrobiosystems.com if you have any question on this product.


Limited Use License

The Biotin AviTag technology is covered by U.S. Pat. No: 5,874,239 and includes any and all materials, methods, kits and related derivatives claimed by this patent. The purchase of the Acrobiosystems’s Avitag™ proteins confers to the purchaser the limited right to use the Avitag™ technology for non-commercial, or research use, or for purposes of evaluating the Avitag™ technology.

Commercial use of the Avitag™ technology to manufacture a commercial product, or use of the Avitag™ technology to facilitate or advance research which will be applied to the development of a commercial product requires a license from Avidity, LLC. Examples of Commercial use include, but are not limited to biosensors, diagnostics, therapeutic applications, proximity assays, and drug screening assays.

Related Products